Loading...
Statistics
Advertisement

糖尿病食の宅配で安い所は？ ...
www.banacchi.com/

Banacchi.com

Advertisement
Conversion Technology Metas Server
Banacchi.com is hosted in Japan / Osaka . Banacchi.com uses HTTPS protocol. Number of used technologies: 3. First technologies: CSS, Html, Javascript, Number of used javascripts: 0. First javascripts: Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Banacchi.com

Technology

Number of occurences: 3
  • CSS
  • Html
  • Javascript

Advertisement

Javascripts

Number of occurences: 0

Server Type

  • Apache

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Banacchi.com

SSL certificate

    • name: /OU=Domain Control Validated/OU=CoreSSL DV Wildcard/CN=*.firebird.netowl.jp
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: CoreSSL DV Wildcard
      • CN: *.firebird.netowl.jp
    • hash: dc745b92
    • issuer:
      • C: JP
      • ST: OSAKA
      • L: OSAKA
      • O: SecureCore
      • CN: SecureCore RSA DV CA
    • version: 2
    • serialNumber: 292790285963296008064818189188372684314
    • validFrom: 151201000000Z
    • validTo: 181231235959Z
    • validFrom_time_t: 1448928000
    • validTo_time_t: 1546300799
    • extensions:
      • authorityKeyIdentifier: keyid:87:B2:E6:D0:DF:DF:0C:E3:2D:97:D2:24:08:A9:50:8F:27:0B:90:69
      • subjectKeyIdentifier: 90:8E:EF:D7:47:84:EA:B5:5D:5E:83:37:BA:AB:F4:9C:0E:03:1A:C0
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.50 CPS: https://cps.securecore-ca.com Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.securecore-ca.com/SecureCoreRSADVCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.securecore-ca.com/SecureCoreRSADVCA.crt OCSP - URI:http://ocsp.securecore-ca.com
      • subjectAltName: DNS:*.firebird.netowl.jp, DNS:firebird.netowl.jp

Meta - Banacchi.com

Number of occurences: 3
  • Name:
    Content: text/css
  • Name: keywords
    Content:
  • Name: description
    Content:

Server / Hosting

  • IP: 112.78.117.107
  • Latitude: 34.69
  • Longitude: 135.52
  • Country: Japan
  • City: Osaka

Rname

  • ns1.firebird.jp
  • ns3.firebird.jp
  • ns2.firebird.jp
  • banacchi.com

Target

  • root.sv0.firebird.jp

HTTP Header Response

HTTP/1.1 301 Moved Permanently Date: Sat, 18 Jun 2016 03:15:05 GMT Server: Apache Location: http://www.banacchi.com/ Content-Type: text/html; charset=iso-8859-1 X-Cache: MISS from s_xt27 X-Cache-Lookup: MISS from s_xt27:80 Via: 1.1 s_xt27 (squid/3.5.6) Connection: keep-alive HTTP/1.1 200 OK Date: Sat, 18 Jun 2016 03:15:06 GMT Server: Apache Last-Modified: Tue, 16 Feb 2016 08:50:24 GMT ETag: "9f854f4-1c8d-52bdf396f4155" Accept-Ranges: bytes Content-Length: 7309 Vary: User-Agent Content-Type: text/html X-Cache: MISS from s_xt27 X-Cache-Lookup: MISS from s_xt27:80 Via: 1.1 s_xt27 (squid/3.5.6) Connection: keep-alive

DNS

host: banacchi.com
  1. class: IN
  2. ttl: 3600
  3. type: A
  4. ip: 112.78.117.107
host: banacchi.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns1.firebird.jp
host: banacchi.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns3.firebird.jp
host: banacchi.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns2.firebird.jp
host: banacchi.com
  1. class: IN
  2. ttl: 3600
  3. type: SOA
  4. mname: ns1.firebird.jp
  5. rname: root.sv0.firebird.jp
  6. serial: 0
  7. refresh: 10800
  8. retry: 3600
  9. expire: 604800
  10. minimum-ttl: 3600
host: banacchi.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 0
  5. target: banacchi.com

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.anacchi.com, www.bqanacchi.com, www.qanacchi.com, www.bwanacchi.com, www.wanacchi.com, www.bzanacchi.com, www.zanacchi.com, www.bxanacchi.com, www.xanacchi.com, www.banacchi.com, www.anacchi.com, www.bsanacchi.com, www.sanacchi.com, www.byanacchi.com, www.yanacchi.com, www.beanacchi.com, www.eanacchi.com, www.bdanacchi.com, www.danacchi.com, www.bcanacchi.com, www.canacchi.com, www.bnacchi.com, www.baonacchi.com, www.bonacchi.com, www.bapnacchi.com, www.bpnacchi.com, www.ba9nacchi.com, www.b9nacchi.com, www.banacchi.com, www.bnacchi.com, www.bainacchi.com, www.binacchi.com, www.baunacchi.com, www.bunacchi.com, www.baacchi.com, www.bannacchi.com, www.banacchi.com, www.banhacchi.com, www.bahacchi.com, www.banjacchi.com, www.bajacchi.com, www.bankacchi.com, www.bakacchi.com, www.banlacchi.com, www.balacchi.com, www.ban acchi.com, www.ba acchi.com, www.bancchi.com, www.banaocchi.com, www.banocchi.com, www.banapcchi.com, www.banpcchi.com, www.bana9cchi.com, www.ban9cchi.com, www.banacchi.com, www.bancchi.com, www.banaicchi.com, www.banicchi.com, www.banaucchi.com, www.banucchi.com, www.banachi.com, www.banacdchi.com, www.banadchi.com, www.banacrchi.com, www.banarchi.com, www.banactchi.com, www.banatchi.com, www.banacvchi.com, www.banavchi.com, www.banacfchi.com, www.banafchi.com, www.banacgchi.com, www.banagchi.com, www.banachchi.com, www.banahchi.com, www.banacnchi.com, www.bananchi.com, www.banacmchi.com, www.banamchi.com, www.banacjchi.com, www.banajchi.com, www.banachi.com, www.banaccdhi.com, www.banacdhi.com, www.banaccrhi.com, www.banacrhi.com, www.banaccthi.com, www.banacthi.com, www.banaccvhi.com, www.banacvhi.com, www.banaccfhi.com, www.banacfhi.com, www.banaccghi.com, www.banacghi.com, www.banacchhi.com, www.banachhi.com, www.banaccnhi.com, www.banacnhi.com, www.banaccmhi.com, www.banacmhi.com, www.banaccjhi.com, www.banacjhi.com, www.banacci.com, www.banacchei.com, www.banaccei.com, www.banacchdi.com, www.banaccdi.com, www.banacchci.com, www.banaccci.com, www.banacchui.com, www.banaccui.com, www.banacchji.com, www.banaccji.com, www.banacchi.com, www.banacci.com, www.banacchbi.com, www.banaccbi.com, www.banacchgi.com, www.banaccgi.com, www.banacch.com, www.banacchir.com, www.banacchr.com, www.banacchif.com, www.banacchf.com, www.banacchiv.com, www.banacchv.com, www.banacchik.com, www.banacchk.com, www.banacchi,.com, www.banacch,.com, www.banacchib.com, www.banacchb.com, www.banacchig.com, www.banacchg.com, www.banacchit.com, www.banaccht.com, www.banacchiy.com, www.banacchy.com, www.banacchiu.com, www.banacchu.com, www.banacchij.com, www.banacchj.com, www.banacchim.com, www.banacchm.com, www.banacchin.com, www.banacchn.com,

Other websites we recently analyzed

  1. alpsankhyakpiccharavargkalyansamiti.org
    Austin (United States) - 209.99.40.219
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  2. profoshow.com
    Road Town (Virgin Islands, British) - 208.91.197.218
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  3. Goldrausch Friseure in Wiesbaden - Home
    Wir, die Goldrausch-Friseure kümmern uns um Ihre menschliche Sehnsucht nach Schönheit. Teamgeist, Mut und Stolz für die Aufgabe sowie Freude an der täglichen Arbeit führen uns virtuos mit Auge, Gefühl und Hand zur Gestaltung typgerechter Frisurenwelten.
    Germany - 89.31.143.122
    Server software: UD Webspace 3.0
    Technology: CSS, Html, Javascript, Google Analytics, Share This Social Media Buttons
    Number of Javascript: 9
    Number of meta tags: 8
  4. Home - Apartamento En GazcueApartamento En Gazcue
    Scottsdale (United States) - 23.229.238.193
    G Analytics ID: UA-39150543-11
    Server software: Apache/2.4.12
    Technology: Google Font API, Html, Javascript, jQuery, Lightbox, Php, Pingback, Google Analytics, Wordpress
    Number of Javascript: 10
    Number of meta tags: 5
  5. enbuscadevalentina.es
    Germany - 217.160.230.116
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  6. Welcome to Sadhana Travels
    Scottsdale (United States) - 72.167.131.46
    Server software: Microsoft-IIS/7.0
    Technology: Html, Swf Object
    Number of meta tags: 3
  7. hotelin-biograd.com
    Croatia - 178.218.166.196
    Server software: Apache
    Technology: CSS, Google Font API, Html, Html5, Iframe, Javascript, jQuery, jQuery Validate, jQuery UI, Php, Pingback, W3 Total cache, Wordpress
    Number of Javascript: 30
    Number of meta tags: 9
  8. itsyourturnjack.net
    Scottsdale (United States) - 184.168.221.36
    Server software: squid/3.5.19
    Technology: Html, Html5, Iframe
  9. Geocaching: Team MetaStabil
    Berlin (Germany) - 81.169.145.94
    Server software: Apache/2.2.31 (Unix)
    Technology: CSS, Html, Javascript
    Number of Javascript: 3
    Number of meta tags: 1
  10. Bakelite Door Furniture and Cabinet Pulls. All modelled on the originals.
    Bakelite lifestyle images - for a true period look.
    United Kingdom - 93.174.140.31
    Server software: Apache
    Technology: BootstrapCDN, Maxcdn, CSS, Font Awesome, Html, Javascript, jQuery, Php
    Number of Javascript: 4
    Number of meta tags: 4

Check Other Websites